Venom Protein Card


Accession: Pre00110    Phospholipases A2   [Bracon nigricans]

Basic info
Organism Bracon nigricans
Taxonomy Insecta > Hymenoptera > Braconidae > Habrobracon > Bracon nigricans
Protein Description Phospholipases A2
Mass Weight 18965.57 Da
Isoelectric Point 7.12
Expression Highly expressed in venom gland
Annotation
Function PLA2s (EC 3.1.1.4) are a large super-family of lipolytic enzymes that cleave the glycerol backbone of phospholipids, usually in a metal-dependent reaction, to release free fatty acids and lysophospholipids. These products of lipid hydrolysis (i.e., arachidonic and linoleic acid) are cytotoxic, as demonstrated by many studies on catalytically active venom PLA2s exerting neurotoxic [68, 69], myotoxic, anticoagulant and antibacterial activities. A pharmacological effect independent of catalytic activity is also predicted for divergent putative homologs of BnPLA2 in other Hymenoptera
Pfam
PF05826 Phospholip_A2_2
Features
Feature key Position Length
Signal Peptide 1..21 21
Chain 22..167 146
Cross-Reference
Sequence
MAAITYIIVLVLLIWTSMVSSTFFKPGKWCGPDPNKALQSGSLGERILAICCKIHDECGHVIGPKQTYQGVTNDGYANIYECRCDREFHVCLGQTEHPYLDMAKQLHYDTVHAPCWYKKNGRAVISEHTVREKHESLYELVRSKDQHKQWVKDNAHNLLPAELGVPA

3D Structure
Publication
1. Becchimanzi A, Avolio M, Bostan H, Colantuono C, Cozzolino F, Mancini D, Chiusano ML, Pucci P, Caccia S, Pennacchio F.;
Venomics of the ectoparasitoid wasp Bracon nigricans.;
BMC Genomics 2020 Jan 10;21(1):34.