Venom Protein Card


Accession: Pre01646    P17   [Tetramorium bicarinatum]

Basic info
Organism Tetramorium bicarinatum
Taxonomy Insecta > Hymenoptera > Formicidae > Tetramorium > Tetramorium bicarinatum
Protein Description P17
Mass Weight 7103.19 Da
Isoelectric Point 4.85
Expression Highly expressed in venom gland
Annotation
Function Unknown. Does not show antimicrobial activity when tested on S.aureus and S.xylosus (Ref.2). Does not show hemolytic activity (Ref.2).
Pfam
PF17499 Pilosulin
Features
Feature key Position Length
Signal Peptide 1..17 17
Propeptide 18..52 35
Peptide 53..65 13
Cross-Reference
NCBI Nucleotide KM030176.1
NCBI Protein AIO11144.1
UniProt A0A088SG62
Sequence
ATGAAACTATCATTTTTATCATTGGCGCTTGCCACAATCTTTGTTATGGCAATCATATACGCGCCCCAAATGGAAGCAAGAGCCTCGTCCGACGCTGATGCTGATGCTGCTGCTTCTGCCGACGCTGATGCTGATGCCCTTGCCGAAGCCAGTGCTCTATTCAAAGAAATTTTGGAAAAAATTAAAGCCAAGTTGGGAAAGAAGTAG
MKLSFLSLALATIFVMAIIYAPQMEARASSDADADAAASADADADALAEASALFKEILEKIKAKLGKK

3D Structure
Publication
1. Bouzid W., Klopp C., Verdenaud M., Ducancel F., Vetillard A.;
"Profiling the venom gland transcriptome of Tetramorium bicarinatum (Hymenoptera: Formicidae): the first transcriptome analysis of an ant species.";
Toxicon 70:70-81(2013).
2. Bonnafe E., Allaoua M., Rifflet A., Treilhou M.;
"Cloning of total p17 cDNA using a modified RACE PCR strategy."; Submitted (JUN-2014) to the EMBL/GenBank/DDBJ databases.
3. Rifflet A., Gavalda S., Tene N., Orivel J., Leprince J., Guilhaudis L., Genin E., Vetillard A., Treilhou M.;
"Identification and characterization of a novel antimicrobial peptide from the venom of the ant Tetramorium bicarinatum.";
Peptides 38:363-370(2012).
4. Touchard A., Aili S.R., Fox E.G., Escoubas P., Orivel J., Nicholson G.M., Dejean A.;
"The biochemical toxin arsenal from ant venoms.";
Toxins 8:1-28(2016).
5. Robinson S.D., Mueller A., Clayton D., Starobova H., Hamilton B.R., Payne R.J., Vetter I., King G.F., Undheim E.A.B.;
"A comprehensive portrait of the venom of the giant red bull ant, Myrmecia gulosa, reveals a hyperdiverse hymenopteran toxin gene family.";
Sci. Adv. 4:EAAU4640-EAAU4640(2018).