Venom Protein Card


Accession: Pre05380    Melittin precursor   [Apis cerana]

Basic info
Organism Apis cerana
Taxonomy Insecta > Hymenoptera > Apidae > Apis > Apis cerana
Protein Description Melittin precursor
Mass Weight 7542.72 Da
Isoelectric Point 4.69
Expression Highly expressed in venom gland
Annotation
Function Main toxin of bee venom with strong hemolytic activity and antimicrobial activity. It has enhancing effects on bee venom phospholipase A2 activity. This amphipathic toxin binds to negatively charged membrane surface and forms pore by inserting into lipid bilayers inducing the leakage of ions and molecules and the enhancement of permeability that ultimately leads to cell lysis. It acts as a voltage-gated pore with higher selectivity for anions over cations. The ion conductance has been shown to be voltage-dependent. Self- association of melittin in membranes is promoted by high ionic strength, but not by the presence of negatively charged lipids. In vivo, intradermal injection into healthy human volunteers produce sharp pain sensation and an inflammatory response. It produces pain by activating primary nociceptor cells directly and indirectly due to its ability to activate plasma membrane phospholipase A2 and its pore- forming activity.
Pfam
PF01372 Melittin
Features
Feature key Position Length
Signal Peptide 1..21 21
Propeptide 22..43 22
Peptide 44..69 26
Cross-Reference
NCBI Nucleotide AJ786346.1
NCBI Protein CAH05131.1
UniProt P68407
Sequence
ATGAAATTCTTAGTCAACGTTGCCCTTGTTTTTATGGTTGTATACATTTCTTTCATCTATGCGGCCCCTGAACCAGAACCGGCACCGGAGGCAGAGGCAGAGGCAGACGCGGAGGCAGATCCGGAAGCAGGAATTGGAGCAGTTCTCAAAGTATTAACCACAGGATTGCCTGCCCTTATAAGTTGGATTAAACGTAAGAGGCAACAGGGTTAG
MKFLVNVALVFMVVYISFIYAAPEPEPAPEAEAEADAEADPEAGIGAVLKVLTTGLPALISWIKRKRQQG

3D Structure
Publication
1. Li J.-H., Zhang C.-X.;
"Transcription and expression of melittin gene in the venom gland of the Chinese honeybee, Apis cerana."; Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases.
2. Diao Q., Sun L., Zheng H., Zheng H., Xu S., Wang S., Zeng Z., Hu F., Su S., Wu J.;
"Genomic and transcriptomic analysis on Apis cerana provide comprehensive insights into honey bee biology."; Submitted (JUL-2014) to the EMBL/GenBank/DDBJ databases.