Venom Protein Card


Accession: Pre05406    Venom serine protease inhibitor   [Apis cerana]

Basic info
Organism Apis cerana
Taxonomy Insecta > Hymenoptera > Apidae > Apis > Apis cerana
Protein Description Venom serine protease inhibitor
Mass Weight 9732.73 Da
Isoelectric Point 10.05
Expression Highly expressed in venom gland
Annotation
Function Antifibrinolytic and antimicrobial serine protease inhibitor. Inhibits trypsin, plasmin and microbial serine proteases but not chymotrypsin, thrombin and elastase. Inhibits the plasmin-mediated degradation of fibrin to fibrin degradation products. Also binds to bacterial and fungal surfaces and exhibits antimicrobial activity against fungi as well as Gram-positive and Gram-negative bacteria.To act as a microbial serine protease inhibitor and plasmin inhibitor. AcVSPI was found to consist of a trypsin inhibitor-like domain that displays ten cysteine residues.
Pfam
PF01826 TIL
Features
Feature key Position Length
Signal Peptide 1..23 23
Chain 24..87 64
Cross-Reference
NCBI Nucleotide MF281990.1
NCBI Protein AVZ66243.1
UniProt A0A2R4SV19
Sequence
ATGCCTCGTCTTGTTCTTGTCTCCTTCCTTTTTTTGGCAATTTTCTCCGTGTTTATTGGAGGATTTGCTAAATCGAAGTGTCCAAGAAATGAGATCTTCACTAGATGCCATGCAGCGTGTCAACCTTCTTGCGCCAGACTTGCTCGTAAACCTTTTTGCATCAAGATATGTAAGCCAGGATGTATATGCACATCCGGTTATTTAAGGAATAAAAATAATGTATGCGTTCCGCGATCTAGATGTTTCTCAGGAAGACTTTTATAA
MPRLVLVSFLFLAIFSVFIGGFAKSKCPRNEIFTRCHAACQPSCARLARKPFCIKICKPGCICTSGYLRNKNNVCVPRSRCFSGRLL

3D Structure
Publication
1. Yang J., Lee K.S., Kim B.Y., Choi Y.S., Yoon H.J., Jia J., Jin B.R.;
"Anti-fibrinolytic and anti-microbial activities of a serine protease inhibitor from honeybee (Apis cerana) venom.";
Comp. Biochem. Physiol. 201:11-18(2017).